(data stored in ACNUC7421 zone)

EMBL: CP000769.PE415

CP000769.PE415       Location/Qualifiers
FT   CDS             477086..478000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0420"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ade:Adeh_4004 ABC
FT                   phosphate transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24635"
FT                   /db_xref="GOA:A7H7D9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D9"
FT                   /protein_id="ABS24635.1"
FT                   /translation="MSVASRKVVGTGLTVLTGATAALVVAMLAVILVDVVRGGAARVSW
FT                   EFLTAAPEEGMTAGGIFPAIYGTAIMTLIMTVAVMPVGVLTAVYLHEYAAPRSRMAALV
FT                   RVAVTNLAGVPSIVFGLFGLGFFIQFVGGSLDRAFSPPGELFYGRPALLWAALTLAVLT
FT                   LPVVIVSTEEALRAVPRDHRDASLALGATKSQTLVRVILPQALPGILTGAILAVARGAG
FT                   EVAPILFTGVAYFLPDLPGSVWSQFMHLGYHVYVLATQSPDIDATRPLLYATVFVLLAL
FT                   TFALNLLAIAIRTRTRRKAAAGH"
     MSVASRKVVG TGLTVLTGAT AALVVAMLAV ILVDVVRGGA ARVSWEFLTA APEEGMTAGG        60
     IFPAIYGTAI MTLIMTVAVM PVGVLTAVYL HEYAAPRSRM AALVRVAVTN LAGVPSIVFG       120
     LFGLGFFIQF VGGSLDRAFS PPGELFYGRP ALLWAALTLA VLTLPVVIVS TEEALRAVPR       180
     DHRDASLALG ATKSQTLVRV ILPQALPGIL TGAILAVARG AGEVAPILFT GVAYFLPDLP       240
     GSVWSQFMHL GYHVYVLATQ SPDIDATRPL LYATVFVLLA LTFALNLLAI AIRTRTRRKA       300
     AAGH                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page