(data stored in ACNUC7421 zone)

EMBL: CP000769.PE417

CP000769.PE417       Location/Qualifiers
FT   CDS             478810..479505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0422"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   ade:Adeh_4002 phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24637"
FT                   /db_xref="GOA:A7H7E1"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E1"
FT                   /protein_id="ABS24637.1"
FT                   /translation="MVTTHTDKAYEAELKDLRDKLLEMGGLVERAMAASVRSITERDTP
FT                   LAEQVKERDREINRMEVAIDSACRRVLALRQPAASDLRFITTALKIVTDLERMGDLAVN
FT                   VAERAIDLNKVAPLGPLHDLSRLAEMSETQLKHALDAFVTGDVAKAEDVMRSDEHLDAL
FT                   YLKIFNDLLAMMMEDSRNIRRATSLMFAAKHLERFGDHATNLAEMVVYMVRGTDVRHPR
FT                   SRAPSAPPA"
     MVTTHTDKAY EAELKDLRDK LLEMGGLVER AMAASVRSIT ERDTPLAEQV KERDREINRM        60
     EVAIDSACRR VLALRQPAAS DLRFITTALK IVTDLERMGD LAVNVAERAI DLNKVAPLGP       120
     LHDLSRLAEM SETQLKHALD AFVTGDVAKA EDVMRSDEHL DALYLKIFND LLAMMMEDSR       180
     NIRRATSLMF AAKHLERFGD HATNLAEMVV YMVRGTDVRH PRSRAPSAPP A                231
//

If you have problems or comments...

PBIL Back to PBIL home page