(data stored in ACNUC7421 zone)

EMBL: CP000769.PE421

CP000769.PE421       Location/Qualifiers
FT   CDS             complement(482004..482804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24641"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E5"
FT                   /protein_id="ABS24641.1"
FT                   /translation="MNDRHPGRTASRAAPLLGLALALATGCAAQRAASPATSPSAVSPP
FT                   APEAGARAGDEPPDAGAESTWGARDSAAPKDAEPAAVAEGDPELEAVRARVVDAARALV
FT                   GRRFRGDCSAFVLRAFHEAGVRVRLGPGVSRSESLHRASRPLETPRPGALAFFHDSYDR
FT                   DRDRRRDDRFTHVALVERVEGSSVILLHRARKGVERTRMDLSRPGDPDANGRLRVRRRG
FT                   DPRGTRYLTGELFAAFGELLEGEFTQMLQAGRAVETDDRHPAPR"
     MNDRHPGRTA SRAAPLLGLA LALATGCAAQ RAASPATSPS AVSPPAPEAG ARAGDEPPDA        60
     GAESTWGARD SAAPKDAEPA AVAEGDPELE AVRARVVDAA RALVGRRFRG DCSAFVLRAF       120
     HEAGVRVRLG PGVSRSESLH RASRPLETPR PGALAFFHDS YDRDRDRRRD DRFTHVALVE       180
     RVEGSSVILL HRARKGVERT RMDLSRPGDP DANGRLRVRR RGDPRGTRYL TGELFAAFGE       240
     LLEGEFTQML QAGRAVETDD RHPAPR                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page