(data stored in ACNUC7421 zone)

EMBL: CP000769.PE423

CP000769.PE423       Location/Qualifiers
FT   CDS             complement(483775..484539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0428"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ade:Adeh_3998 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24643"
FT                   /db_xref="GOA:A7H7E7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E7"
FT                   /protein_id="ABS24643.1"
FT                   /translation="MRASLRTGLLLLVPLVVWELLSRIGPWPHWLFPGPLAVAGSLGRM
FT                   LADGRLGAATGRSLARLAQGYTFSAVAGVPFGVLLARSELVRGGLRPIVLGLQALPSIC
FT                   WLPLAILWFGLSETAILFVVVMGSVFAIAIATEDAVSGVDPLLLRAAGTLGIRGARFHG
FT                   GVLLPAALPGILTGLKLGWSFAWRALMAGELLFVAGGLGQLLQNGRELLDAAQVMGVML
FT                   AIVAIGVAIDRVLFRVVELRVRRRWGLVEEPA"
     MRASLRTGLL LLVPLVVWEL LSRIGPWPHW LFPGPLAVAG SLGRMLADGR LGAATGRSLA        60
     RLAQGYTFSA VAGVPFGVLL ARSELVRGGL RPIVLGLQAL PSICWLPLAI LWFGLSETAI       120
     LFVVVMGSVF AIAIATEDAV SGVDPLLLRA AGTLGIRGAR FHGGVLLPAA LPGILTGLKL       180
     GWSFAWRALM AGELLFVAGG LGQLLQNGRE LLDAAQVMGV MLAIVAIGVA IDRVLFRVVE       240
     LRVRRRWGLV EEPA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page