(data stored in ACNUC7421 zone)

EMBL: CP000769.PE428

CP000769.PE428       Location/Qualifiers
FT   CDS             488787..490385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0433"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_3988 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24648"
FT                   /db_xref="GOA:A7H7F2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F2"
FT                   /protein_id="ABS24648.1"
FT                   /translation="MISVQNVTKAFGPKKLFEDVNVAFSPGNRYGLTGPNGAGKTTFMK
FT                   ILAGDEEADEGSVLRPKKLGILRQDHFRYEDNRVLDVVLMGNVGLWSALQQKEALLAKD
FT                   EISEEDGTRLGELEGTIAEEDGYSAEADASELLQGLGIEQPWHDQPMRALTGGYKLRVL
FT                   LAQALFGKPQGLLLDEPTNHLDIESIRWLEKFLHAYEGVLITISHDRHFLNAICTHIAD
FT                   IDYETIITYPGGYDDMVRHKGQVRSRVESENAEKKKKIEQLREFVARFHAGTRASQVQS
FT                   RIRAMQKLKLEDMKRSNIQAPFIKFEQKAPSGKQTLTLEAIEKRYGGNEVVQPFSALVT
FT                   RGEKICVIGKNGVGKTTLAKMIAGELQPDHGHVKWGHQAQVGYLPQDQQGVIRPGTTAF
FT                   GWLRELEDKLSNEEISGLLGRMLFSGEERMKPTATLSGGETVRLLLAKLMLFKDNVLVL
FT                   DEPTNHLDLQSIAALSEGLQRYEGTIIVVTHDQELIREVGTRIWSMHQGEPVLDFPGTF
FT                   DEFVAKHPDLATAHA"
     MISVQNVTKA FGPKKLFEDV NVAFSPGNRY GLTGPNGAGK TTFMKILAGD EEADEGSVLR        60
     PKKLGILRQD HFRYEDNRVL DVVLMGNVGL WSALQQKEAL LAKDEISEED GTRLGELEGT       120
     IAEEDGYSAE ADASELLQGL GIEQPWHDQP MRALTGGYKL RVLLAQALFG KPQGLLLDEP       180
     TNHLDIESIR WLEKFLHAYE GVLITISHDR HFLNAICTHI ADIDYETIIT YPGGYDDMVR       240
     HKGQVRSRVE SENAEKKKKI EQLREFVARF HAGTRASQVQ SRIRAMQKLK LEDMKRSNIQ       300
     APFIKFEQKA PSGKQTLTLE AIEKRYGGNE VVQPFSALVT RGEKICVIGK NGVGKTTLAK       360
     MIAGELQPDH GHVKWGHQAQ VGYLPQDQQG VIRPGTTAFG WLRELEDKLS NEEISGLLGR       420
     MLFSGEERMK PTATLSGGET VRLLLAKLML FKDNVLVLDE PTNHLDLQSI AALSEGLQRY       480
     EGTIIVVTHD QELIREVGTR IWSMHQGEPV LDFPGTFDEF VAKHPDLATA HA               532
//

If you have problems or comments...

PBIL Back to PBIL home page