(data stored in ACNUC7421 zone)

EMBL: CP000769.PE429

CP000769.PE429       Location/Qualifiers
FT   CDS             490513..491298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24649"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F3"
FT                   /protein_id="ABS24649.1"
FT                   /translation="MREVVVAVLSLGFALGARAAEFEGKAEYRVKGVGAGPARDGSAVV
FT                   YLSPKGSRSEVEIAASPELASQGMTEPMRMISIVKAGEPGRAYVVNPGTKSYSVLDGQP
FT                   EGKAGSWTVERAGSDRVGGVGCERARISGSGGERFEVCITRELGTVGSWAASGGGQDAE
FT                   LPRALKKAGLDGLPARWSVVDPATGAPQMTMELVRAARQKVPAAMFEIPAGYAKTSVPQ
FT                   ASPEMQRKLEEAMKDMPPEQRKQLEEMMRRGGGDRPPGR"
     MREVVVAVLS LGFALGARAA EFEGKAEYRV KGVGAGPARD GSAVVYLSPK GSRSEVEIAA        60
     SPELASQGMT EPMRMISIVK AGEPGRAYVV NPGTKSYSVL DGQPEGKAGS WTVERAGSDR       120
     VGGVGCERAR ISGSGGERFE VCITRELGTV GSWAASGGGQ DAELPRALKK AGLDGLPARW       180
     SVVDPATGAP QMTMELVRAA RQKVPAAMFE IPAGYAKTSV PQASPEMQRK LEEAMKDMPP       240
     EQRKQLEEMM RRGGGDRPPG R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page