(data stored in ACNUC7421 zone)

EMBL: CP000769.PE431

CP000769.PE431       Location/Qualifiers
FT   CDS             492255..493088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24651"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F5"
FT                   /protein_id="ABS24651.1"
FT                   /translation="MRRQVKGEAVRRELLPGTSPELLKELHLLTRAGDLNADSLRKLKQ
FT                   VNHLAGLLAPALDDVLARFGDPVLVDCGAGKSYLGFVLYELFLRAAGKGRLLALESRPE
FT                   LARAGAERAARLGFERLRFVEASIAAAPVPERVHLVTALHACDTATDDALALAIRHGAD
FT                   HVAVVPCCQAEVARQLAGAPAPSPLLAPLFDHPWHRREFGSHLTNVVRALALEAAGYKV
FT                   TVTELTGWEHSLKNELILGRKVRSGSREARERLDALLAAAGVRPKLVRLLAGEEA"
     MRRQVKGEAV RRELLPGTSP ELLKELHLLT RAGDLNADSL RKLKQVNHLA GLLAPALDDV        60
     LARFGDPVLV DCGAGKSYLG FVLYELFLRA AGKGRLLALE SRPELARAGA ERAARLGFER       120
     LRFVEASIAA APVPERVHLV TALHACDTAT DDALALAIRH GADHVAVVPC CQAEVARQLA       180
     GAPAPSPLLA PLFDHPWHRR EFGSHLTNVV RALALEAAGY KVTVTELTGW EHSLKNELIL       240
     GRKVRSGSRE ARERLDALLA AAGVRPKLVR LLAGEEA                                277
//

If you have problems or comments...

PBIL Back to PBIL home page