(data stored in ACNUC7421 zone)

EMBL: CP000769.PE434

CP000769.PE434       Location/Qualifiers
FT   CDS             495882..496721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24654"
FT                   /db_xref="InterPro:IPR031823"
FT                   /db_xref="InterPro:IPR038537"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F8"
FT                   /protein_id="ABS24654.1"
FT                   /translation="MSFVSDAVAQSGSSYATDDDPELVRGAVPFGLKTMEGLLSEDPHH
FT                   EGLLRALAGNFTQYAYAFVQADADLADLQGNLDAARAGRERARKLYLRARDYGLRALEQ
FT                   RHDGLSKRLREGRDVAGALKAAEKKDVEVLYWTASAWTLAIANGKGDMGLVAELPVPVA
FT                   MMERALALDEKWGQGALHEYFVSLDAARGEVEGGGPARAKAHLERALELSMNKKLGPRV
FT                   AYAEGVLVKQQDRAAFERELGVVLQANPDEAPEHRLANILAQRRARALLDHVDDLFL"
     MSFVSDAVAQ SGSSYATDDD PELVRGAVPF GLKTMEGLLS EDPHHEGLLR ALAGNFTQYA        60
     YAFVQADADL ADLQGNLDAA RAGRERARKL YLRARDYGLR ALEQRHDGLS KRLREGRDVA       120
     GALKAAEKKD VEVLYWTASA WTLAIANGKG DMGLVAELPV PVAMMERALA LDEKWGQGAL       180
     HEYFVSLDAA RGEVEGGGPA RAKAHLERAL ELSMNKKLGP RVAYAEGVLV KQQDRAAFER       240
     ELGVVLQANP DEAPEHRLAN ILAQRRARAL LDHVDDLFL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page