(data stored in ACNUC7421 zone)

EMBL: CP000769.PE436

CP000769.PE436       Location/Qualifiers
FT   CDS             complement(497727..498653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24656"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G0"
FT                   /protein_id="ABS24656.1"
FT                   /translation="MIRPMAPLLDRAIDGLAMWMEDRRPREPMGFRPAPAASLDCFGPL
FT                   PVLPAGPPREGAWHAPSPRPAEGDATMAVHAQAARGPRRGTALLVPPWKVPRLAAVSGY
FT                   ARLLARAGYAVWTLVPPRHLHRAPPGLRSGEGFVSPDLPALRAAFEQLVLEIRILVTLA
FT                   RAEGGTVGVVGLSLGALGAALAATAPEPLDFAALVAPPADLAAVFAGTPIGRRYLSLAR
FT                   RAGAPVPPPDALSRMLAPFRADQRRPTARRVLVAVGTDDRIALGAGALGLAAAWGAAAR
FT                   RYPRGHLTLLFACRALRRDLARFVAAG"
     MIRPMAPLLD RAIDGLAMWM EDRRPREPMG FRPAPAASLD CFGPLPVLPA GPPREGAWHA        60
     PSPRPAEGDA TMAVHAQAAR GPRRGTALLV PPWKVPRLAA VSGYARLLAR AGYAVWTLVP       120
     PRHLHRAPPG LRSGEGFVSP DLPALRAAFE QLVLEIRILV TLARAEGGTV GVVGLSLGAL       180
     GAALAATAPE PLDFAALVAP PADLAAVFAG TPIGRRYLSL ARRAGAPVPP PDALSRMLAP       240
     FRADQRRPTA RRVLVAVGTD DRIALGAGAL GLAAAWGAAA RRYPRGHLTL LFACRALRRD       300
     LARFVAAG                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page