(data stored in ACNUC7421 zone)

EMBL: CP000769.PE438

CP000769.PE438       Location/Qualifiers
FT   CDS             499279..500211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24658"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G2"
FT                   /protein_id="ABS24658.1"
FT                   /translation="MAENEGSSGSAAAVFGRARPPSVSLPDRGVVIGLRWSGVEGAGNQ
FT                   ILAAKIECGRTKVRLTRLWRPFTDAPGRRDVHVRFAGWLAEEAKWAEGRLVVGVDFALS
FT                   LSETHLRQLGLLRQALRGPAVLGRNLHERFVGAGGDFTEGAARFRDELGKDRPRATDCY
FT                   RGELAPPTSARTYRQTFFGLCTLAHVQASFLPWDPPQPGRPSIAEVRPAHVARVLCGVC
FT                   GYRDDDRDGVARASTRAAILRTLRSAAKLEFEMEQAAQVVEDGRGEHLDAVLAATGAAA
FT                   ASEDGFQGVPSNVPRSEGWIHSVREEPWR"
     MAENEGSSGS AAAVFGRARP PSVSLPDRGV VIGLRWSGVE GAGNQILAAK IECGRTKVRL        60
     TRLWRPFTDA PGRRDVHVRF AGWLAEEAKW AEGRLVVGVD FALSLSETHL RQLGLLRQAL       120
     RGPAVLGRNL HERFVGAGGD FTEGAARFRD ELGKDRPRAT DCYRGELAPP TSARTYRQTF       180
     FGLCTLAHVQ ASFLPWDPPQ PGRPSIAEVR PAHVARVLCG VCGYRDDDRD GVARASTRAA       240
     ILRTLRSAAK LEFEMEQAAQ VVEDGRGEHL DAVLAATGAA AASEDGFQGV PSNVPRSEGW       300
     IHSVREEPWR                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page