(data stored in ACNUC7421 zone)

EMBL: CP000769.PE446

CP000769.PE446       Location/Qualifiers
FT   CDS             507777..508526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4018 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24666"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H0"
FT                   /protein_id="ABS24666.1"
FT                   /translation="MGCDESRGRGRGRGRGLIIPHKTGGRIAKVLTPENRAEVLPRFFG
FT                   RSRREAEAVAVSLRPAEVVPTREVVTAFRPAAIRAATVQAALLAPSPESPALRVHPDEP
FT                   TTPVTVAAPRPLPTPPPPRESVERLDAELARVHVTVSRRFLEKLEAATDALGHACPEGN
FT                   AAEILERGLDLILAQHAKRRGLVEKPRKSRGGSRRDTIPAEPSRPAPHGEGGRGGFVSS
FT                   RAVDMYAVSHANFGRPQARENGARRDR"
     MGCDESRGRG RGRGRGLIIP HKTGGRIAKV LTPENRAEVL PRFFGRSRRE AEAVAVSLRP        60
     AEVVPTREVV TAFRPAAIRA ATVQAALLAP SPESPALRVH PDEPTTPVTV AAPRPLPTPP       120
     PPRESVERLD AELARVHVTV SRRFLEKLEA ATDALGHACP EGNAAEILER GLDLILAQHA       180
     KRRGLVEKPR KSRGGSRRDT IPAEPSRPAP HGEGGRGGFV SSRAVDMYAV SHANFGRPQA       240
     RENGARRDR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page