(data stored in ACNUC7421 zone)

EMBL: CP000769.PE45

CP000769.PE45        Location/Qualifiers
FT   CDS             59004..60104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0045"
FT                   /product="Butyrate kinase"
FT                   /note="TIGRFAM: Butyrate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: ade:Adeh_0042 acetate and butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24265"
FT                   /db_xref="GOA:A7H6B9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B9"
FT                   /protein_id="ABS24265.1"
FT                   /translation="MTEATPEHAGPLVLAVNPGAGSTKLALYRGDALVREEKLTHPPLM
FT                   ERPAARVLDELPARLEAARALLSAAAIPLGRLAAVVGRGGLLPPLRSGTYLVDAEMLRD
FT                   LARAERGEHASNLGAPMARALADDHACPAFIVDPVSVDELDPVARVSGLCGVERRSLSH
FT                   ALNMRAVARRHAARAGRALEDLRLVVVHMGTGVSLSAQRDGRMVDVVNPQDEGPFSGDR
FT                   AGGVPAMAVVELCFAPGAEERAVRRRLFGDGGLYSHLRTRDAREAIRRCEAGDSQACLV
FT                   LDAMCYQIAKAVGGLAAALEGRVDAVLLTGGMAHLPHVVEGVRRRVGWIAPVHVLPGED
FT                   ELRALAEGALRVLRGEERPRRYGDRE"
     MTEATPEHAG PLVLAVNPGA GSTKLALYRG DALVREEKLT HPPLMERPAA RVLDELPARL        60
     EAARALLSAA AIPLGRLAAV VGRGGLLPPL RSGTYLVDAE MLRDLARAER GEHASNLGAP       120
     MARALADDHA CPAFIVDPVS VDELDPVARV SGLCGVERRS LSHALNMRAV ARRHAARAGR       180
     ALEDLRLVVV HMGTGVSLSA QRDGRMVDVV NPQDEGPFSG DRAGGVPAMA VVELCFAPGA       240
     EERAVRRRLF GDGGLYSHLR TRDAREAIRR CEAGDSQACL VLDAMCYQIA KAVGGLAAAL       300
     EGRVDAVLLT GGMAHLPHVV EGVRRRVGWI APVHVLPGED ELRALAEGAL RVLRGEERPR       360
     RYGDRE                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page