(data stored in ACNUC7421 zone)

EMBL: CP000769.PE450

CP000769.PE450       Location/Qualifiers
FT   CDS             complement(512725..514188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24670"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H4"
FT                   /protein_id="ABS24670.1"
FT                   /translation="MGERPRPSPLCARTGERGPCQARYTRRPGRPVPRRLSDRRWLEQL
FT                   LDEELLGHDPHQARARLPADVRAAASTPLDLAPAANLLVARSLRRRVAVRVPGEGADRP
FT                   ASARDVFLDEVRAHIGLALDLALLRGDPFVRARRRAEIAAALAAAAGEHALAIEAEPEQ
FT                   PGGASDRAVERAVRGAAEALHARFYPPAEPAHALPLHAGKVAVLRRRLARVVSGYHRDG
FT                   RLVGAALARHGAYAARETLLLVEALAGLLGAAGDGDGAAVRVLRQRQIARLGLGRADAR
FT                   EARRAIVAPRDPEAIADAAPERVRGFLLEQLRLAQLGLKLVEEEPAAWVERFVRAAGLD
FT                   AQAIASAEIEAAAQHADHADWLEALGDGPRAWQGLASDLDVATDEVVERVTVAVTDNLE
FT                   ALVTEIRETGELGQLLARAASGGALSRDEKKKVKAQLIDLAKAVPALAIFAAPGGMLLL
FT                   PLLAKLLPFNLLPSAWEKPAESKRKQVAR"
     MGERPRPSPL CARTGERGPC QARYTRRPGR PVPRRLSDRR WLEQLLDEEL LGHDPHQARA        60
     RLPADVRAAA STPLDLAPAA NLLVARSLRR RVAVRVPGEG ADRPASARDV FLDEVRAHIG       120
     LALDLALLRG DPFVRARRRA EIAAALAAAA GEHALAIEAE PEQPGGASDR AVERAVRGAA       180
     EALHARFYPP AEPAHALPLH AGKVAVLRRR LARVVSGYHR DGRLVGAALA RHGAYAARET       240
     LLLVEALAGL LGAAGDGDGA AVRVLRQRQI ARLGLGRADA REARRAIVAP RDPEAIADAA       300
     PERVRGFLLE QLRLAQLGLK LVEEEPAAWV ERFVRAAGLD AQAIASAEIE AAAQHADHAD       360
     WLEALGDGPR AWQGLASDLD VATDEVVERV TVAVTDNLEA LVTEIRETGE LGQLLARAAS       420
     GGALSRDEKK KVKAQLIDLA KAVPALAIFA APGGMLLLPL LAKLLPFNLL PSAWEKPAES       480
     KRKQVAR                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page