(data stored in ACNUC7421 zone)

EMBL: CP000769.PE451

CP000769.PE451       Location/Qualifiers
FT   CDS             complement(514201..515277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0456"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: ade:Adeh_3964 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24671"
FT                   /db_xref="GOA:A7H7H5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H5"
FT                   /protein_id="ABS24671.1"
FT                   /translation="MAVAPEKEKAIELAVSSIEKAFGKGSIMRLGNEEALVKDVQAVST
FT                   GSVSLDIALGVGGFPRGRIIEIYGPESSGKTTLALHAVAEAQKKGGIAAFVDAEHALDV
FT                   GYARKLGVRTDDLLISQPDTGEQALEIAETLVRSGAIDVLVVDSVAALVPKAELEGEMG
FT                   DAHMGVQARLMSQALRKLTGTISKSSTIVIFINQIRMKIGVMFGNPETTTGGNALKFYA
FT                   TQRLDIRRIGAIKDGDQVIGNRTRVKVVKNKVAPPFKEVEFDIMYGHGISREGDLLDLG
FT                   SNENIVEKSGTWFSFGGERIGQGREQAKAFLREHPEVLQQVEGKLFEKFGIRRGPVAVP
FT                   PPPPDEAEEKKGRARSGR"
     MAVAPEKEKA IELAVSSIEK AFGKGSIMRL GNEEALVKDV QAVSTGSVSL DIALGVGGFP        60
     RGRIIEIYGP ESSGKTTLAL HAVAEAQKKG GIAAFVDAEH ALDVGYARKL GVRTDDLLIS       120
     QPDTGEQALE IAETLVRSGA IDVLVVDSVA ALVPKAELEG EMGDAHMGVQ ARLMSQALRK       180
     LTGTISKSST IVIFINQIRM KIGVMFGNPE TTTGGNALKF YATQRLDIRR IGAIKDGDQV       240
     IGNRTRVKVV KNKVAPPFKE VEFDIMYGHG ISREGDLLDL GSNENIVEKS GTWFSFGGER       300
     IGQGREQAKA FLREHPEVLQ QVEGKLFEKF GIRRGPVAVP PPPPDEAEEK KGRARSGR         358
//

If you have problems or comments...

PBIL Back to PBIL home page