(data stored in ACNUC7421 zone)

EMBL: CP000769.PE454

CP000769.PE454       Location/Qualifiers
FT   CDS             complement(517042..518802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0459"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: DNA polymerase X;
FT                   phosphoesterase PHP domain protein; KEGG: tbd:Tbd_1446 DNA
FT                   polymerase X"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24674"
FT                   /db_xref="GOA:A7H7H8"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H8"
FT                   /protein_id="ABS24674.1"
FT                   /translation="MENAEIARVLSEIADLLELSEGNAFKVRAYRRAAQAVDLHPASVA
FT                   ELWRAGRAGELHGVGAHLAERIGELVETGECREHGRLAAGVPPGVLAMLRLEGMGPKAV
FT                   AAVWKELGVTDLAALEDACRSGRILAATRMGPARARALLAAIARHRARAGRMPLHRALE
FT                   YAEGILARLRTVPGVRRAEVAGGLRRRTETVDDLELLVAADDAAPVLRAFCGLPGVEPV
FT                   LGQATTTTQAKARLRAGIRADLRVLPPGCFGAALHHFTGSKEHTVAIRRRAAQRGLDLS
FT                   EYGVFDREGRRLGGAEEIEVFRAVGLPFIPPELREGSGELEAAEAGRLPRLVEESELLG
FT                   DLHVHSRASSDGRSTLEELARAARALGRRYLAVTDHSRSRPLGLDAERLRAHAAEVRAL
FT                   DARLGGEPQLLAGVEVDVLPSGALDLPEDVLADMDLVVAGVHARFGDSSARTTERLERA
FT                   LRSGVVHVLAHPTGRELGLRDAYPLDLERLLSVAREEGVALEVNAMPERLDLTDAGCRA
FT                   AGAAGVPVVISTDAHDAAQLANLRYGVWVARRGWLEAKDVLNTLPLEGLARRLARVTRA
FT                   PDRAHGGSSR"
     MENAEIARVL SEIADLLELS EGNAFKVRAY RRAAQAVDLH PASVAELWRA GRAGELHGVG        60
     AHLAERIGEL VETGECREHG RLAAGVPPGV LAMLRLEGMG PKAVAAVWKE LGVTDLAALE       120
     DACRSGRILA ATRMGPARAR ALLAAIARHR ARAGRMPLHR ALEYAEGILA RLRTVPGVRR       180
     AEVAGGLRRR TETVDDLELL VAADDAAPVL RAFCGLPGVE PVLGQATTTT QAKARLRAGI       240
     RADLRVLPPG CFGAALHHFT GSKEHTVAIR RRAAQRGLDL SEYGVFDREG RRLGGAEEIE       300
     VFRAVGLPFI PPELREGSGE LEAAEAGRLP RLVEESELLG DLHVHSRASS DGRSTLEELA       360
     RAARALGRRY LAVTDHSRSR PLGLDAERLR AHAAEVRALD ARLGGEPQLL AGVEVDVLPS       420
     GALDLPEDVL ADMDLVVAGV HARFGDSSAR TTERLERALR SGVVHVLAHP TGRELGLRDA       480
     YPLDLERLLS VAREEGVALE VNAMPERLDL TDAGCRAAGA AGVPVVISTD AHDAAQLANL       540
     RYGVWVARRG WLEAKDVLNT LPLEGLARRL ARVTRAPDRA HGGSSR                      586
//

If you have problems or comments...

PBIL Back to PBIL home page