(data stored in ACNUC7421 zone)

EMBL: CP000769.PE462

CP000769.PE462       Location/Qualifiers
FT   CDS             528431..528805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0467"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mxa:MXAN_2684 response regulator CheY4"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24682"
FT                   /db_xref="GOA:A7H7I6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I6"
FT                   /protein_id="ABS24682.1"
FT                   /translation="MKVLLVDDTRTLLSLIQVYLMGWQIEFVEAKDGTEGLARAREHRP
FT                   DLVITDVRMPGMDGFELCAAIRADTVLHKTPIVLLTSLADDASRKKGKLVGATAFLTKP
FT                   VSVEELRNTVGGILRLPARR"
     MKVLLVDDTR TLLSLIQVYL MGWQIEFVEA KDGTEGLARA REHRPDLVIT DVRMPGMDGF        60
     ELCAAIRADT VLHKTPIVLL TSLADDASRK KGKLVGATAF LTKPVSVEEL RNTVGGILRL       120
     PARR                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page