(data stored in ACNUC7421 zone)

EMBL: CP000769.PE47

CP000769.PE47        Location/Qualifiers
FT   CDS             complement(61359..63296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24267"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C1"
FT                   /protein_id="ABS24267.1"
FT                   /translation="MASTGAALLLCSFLLAAPAGAAEAVPSPAQAAAPHVARARAARLA
FT                   EDLGWLRLGHWRKGLFGWKSEIDGPQFFLAPEGKEDPAAELEATLEGFFSSGPFADELS
FT                   DPVCRFPARLAFLAARLGLDPAALPPRSCPKRDDFLARVRPAGVTLVFSSYYLNNPSSS
FT                   FGHTLLRLDKAEGAREGKHFELLDYGVDYAATVDTSNAILYAVKGVFGLFKGEFKHYAY
FT                   YYKVRQYGDFESRDLWEYDLAFTPDETALLARHLWELGGTWFAYWYLDENCSYHVLGAL
FT                   EAAAPRLELLARVRGGVVLPSDTVKALFANPGLVRAVHYRPSIRTQFEARARTLSGLEL
FT                   DTAVELASRPSAPFPPALAPARRVAVLDAAQDLLDLRHGRKLVMGEDPRAARLRQALLE
FT                   RRAELPVPSAPLQVPAPEARRPDRGHGSLRAGLMGGASRAYGGFAALEGRLALHDLADP
FT                   LQGYPPTAQIEFLPARLRYYPERSRLELDDASLVKVVSLNPLSRWDQRPSWRMRVGATT
FT                   VRDAGCAGCLAGVAELGGGLGLADLGGAIDLLALGDAELLGAPSLEGIRGAGARLGLGP
FT                   SALVRVRAGDRAVLLADARWRYLPLATPEQTWSVSGTLRLHLTRALSLAVEARAAPEDR
FT                   DVQAGLLLYR"
     MASTGAALLL CSFLLAAPAG AAEAVPSPAQ AAAPHVARAR AARLAEDLGW LRLGHWRKGL        60
     FGWKSEIDGP QFFLAPEGKE DPAAELEATL EGFFSSGPFA DELSDPVCRF PARLAFLAAR       120
     LGLDPAALPP RSCPKRDDFL ARVRPAGVTL VFSSYYLNNP SSSFGHTLLR LDKAEGAREG       180
     KHFELLDYGV DYAATVDTSN AILYAVKGVF GLFKGEFKHY AYYYKVRQYG DFESRDLWEY       240
     DLAFTPDETA LLARHLWELG GTWFAYWYLD ENCSYHVLGA LEAAAPRLEL LARVRGGVVL       300
     PSDTVKALFA NPGLVRAVHY RPSIRTQFEA RARTLSGLEL DTAVELASRP SAPFPPALAP       360
     ARRVAVLDAA QDLLDLRHGR KLVMGEDPRA ARLRQALLER RAELPVPSAP LQVPAPEARR       420
     PDRGHGSLRA GLMGGASRAY GGFAALEGRL ALHDLADPLQ GYPPTAQIEF LPARLRYYPE       480
     RSRLELDDAS LVKVVSLNPL SRWDQRPSWR MRVGATTVRD AGCAGCLAGV AELGGGLGLA       540
     DLGGAIDLLA LGDAELLGAP SLEGIRGAGA RLGLGPSALV RVRAGDRAVL LADARWRYLP       600
     LATPEQTWSV SGTLRLHLTR ALSLAVEARA APEDRDVQAG LLLYR                       645
//

If you have problems or comments...

PBIL Back to PBIL home page