(data stored in ACNUC7421 zone)

EMBL: CP000769.PE471

CP000769.PE471       Location/Qualifiers
FT   CDS             537459..538577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0476"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; PFAM: IspG family protein; KEGG:
FT                   ade:Adeh_3949 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24691"
FT                   /db_xref="GOA:A7H7J5"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J5"
FT                   /protein_id="ABS24691.1"
FT                   /translation="MGGYGQGAAATLGERRKTRGIRLGNVPIGGGAPIAVQSMTTTQTS
FT                   DAPATLAQIRALAEAGADVVRVAVPDRDAAAALPAIVRASPVPLVADIHFDYRLALAAL
FT                   EAGIHGIRLNPGNIGARERVREVVHAARERLVPIRIGVNAGSLEKDIVEKHGWPTAEGM
FT                   VESAERHIRFLEDEGYREIKVSLKAHDVAMTVQANRLFSQRFEYPLHLGVTEAGTLLAG
FT                   TVKSAAGLGILLGDGIGDTIRVSLTADPVEEVRVARLLLKSLGLKFGGATMTSCPTCGR
FT                   CSVDMIPIAERVEKRLATLKGEVAVAVMGCEVNGPGEAAAADVGVAYGHNGVGLLFRGG
FT                   KIVKRMKAEELEDAVVAEAISIASSRTPGERD"
     MGGYGQGAAA TLGERRKTRG IRLGNVPIGG GAPIAVQSMT TTQTSDAPAT LAQIRALAEA        60
     GADVVRVAVP DRDAAAALPA IVRASPVPLV ADIHFDYRLA LAALEAGIHG IRLNPGNIGA       120
     RERVREVVHA ARERLVPIRI GVNAGSLEKD IVEKHGWPTA EGMVESAERH IRFLEDEGYR       180
     EIKVSLKAHD VAMTVQANRL FSQRFEYPLH LGVTEAGTLL AGTVKSAAGL GILLGDGIGD       240
     TIRVSLTADP VEEVRVARLL LKSLGLKFGG ATMTSCPTCG RCSVDMIPIA ERVEKRLATL       300
     KGEVAVAVMG CEVNGPGEAA AADVGVAYGH NGVGLLFRGG KIVKRMKAEE LEDAVVAEAI       360
     SIASSRTPGE RD                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page