(data stored in ACNUC7421 zone)

EMBL: CP000769.PE473

CP000769.PE473       Location/Qualifiers
FT   CDS             539024..540751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0478"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: ade:Adeh_3947 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24693"
FT                   /db_xref="GOA:A7H7J7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H7J7"
FT                   /protein_id="ABS24693.1"
FT                   /translation="MPVVRLSQAFVPTLKEAPADAQVASHKLLVRAGFIRQLGAGIYDY
FT                   LPLAKRTLAKIEAIVREEMDAIGGQEFYLPALHPAEIWKESGRWEVMGDNMFRLKDRKN
FT                   GDYCLGMTHEEIFTAIARDELRSYRQLPQVWYQIQTKFRDEPRPKSGLLRVRQFTMKDA
FT                   YSFDVDRAGLDKSYEDQRRAYERIFTRCGLDFVAVQAHSGAMGGSESSEFMVRTDAGED
FT                   LVAACPRCRYAANTETATSRLASEQDGAGLPKPEKFATPGVVTIEALEQPPYGVAARRQ
FT                   LKTLVYVADEKLVVAVVRGDQELNEAKLQTATGAQVIRPAHPEEIPSLMGARAGSLGAV
FT                   GFSRAKVFVDPSLADRKDMVTGANEDGFHLRGVEVRRDVLTGPHATVAELRTVRAGEGC
FT                   PRCDGTLDVFKALEVGHIFKLGTKYSESMKATVLDADGKAVPIVMGSYGIGVERIMAAA
FT                   IELHHDELGIRWPPAIAPFQATVLTLGPEPELKKAADELVKALSDAGLEVLHDDREERA
FT                   GVKFKDADLVGIPLRISVGKKGLAEGKVEWKLRGDKAVELVPLAEVARRAAEHVRAGR"
     MPVVRLSQAF VPTLKEAPAD AQVASHKLLV RAGFIRQLGA GIYDYLPLAK RTLAKIEAIV        60
     REEMDAIGGQ EFYLPALHPA EIWKESGRWE VMGDNMFRLK DRKNGDYCLG MTHEEIFTAI       120
     ARDELRSYRQ LPQVWYQIQT KFRDEPRPKS GLLRVRQFTM KDAYSFDVDR AGLDKSYEDQ       180
     RRAYERIFTR CGLDFVAVQA HSGAMGGSES SEFMVRTDAG EDLVAACPRC RYAANTETAT       240
     SRLASEQDGA GLPKPEKFAT PGVVTIEALE QPPYGVAARR QLKTLVYVAD EKLVVAVVRG       300
     DQELNEAKLQ TATGAQVIRP AHPEEIPSLM GARAGSLGAV GFSRAKVFVD PSLADRKDMV       360
     TGANEDGFHL RGVEVRRDVL TGPHATVAEL RTVRAGEGCP RCDGTLDVFK ALEVGHIFKL       420
     GTKYSESMKA TVLDADGKAV PIVMGSYGIG VERIMAAAIE LHHDELGIRW PPAIAPFQAT       480
     VLTLGPEPEL KKAADELVKA LSDAGLEVLH DDREERAGVK FKDADLVGIP LRISVGKKGL       540
     AEGKVEWKLR GDKAVELVPL AEVARRAAEH VRAGR                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page