(data stored in ACNUC7421 zone)

EMBL: CP000769.PE474

CP000769.PE474       Location/Qualifiers
FT   CDS             540758..541879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24694"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J8"
FT                   /protein_id="ABS24694.1"
FT                   /translation="MRARLSVGRDGEVLVPPREAEALGLGGGGEVDLVSARGAFALLVP
FT                   ARGDEAPRAWFAGSLAALTVPEVIQFVFTSLKTGVLLLAFGEDAARAAPDTPDRLRRKS
FT                   IYFRDGQVVFASSSDPSDRLGPVLLREGLVGEEELARCARLARAGRPLGQVLVDEGVLG
FT                   PGQLYEGVTRQVREIVLGAFAELTGEFAFLEGPVDDATAVKLPERTRELLLAGMKRLEE
FT                   AEAARAAATTPGPGEPEVTIEIAPPEPAAPARASGPFETYRRIFRRVHAALAAVTPDAA
FT                   DRLNGYLAQLPDKRRAPFAGVHVQHDGDLDVAQVLGNVSAAGAHRGAAARARALEALDE
FT                   LLAFALFEAKNRLPREEAERLLREVGRMQVGKG"
     MRARLSVGRD GEVLVPPREA EALGLGGGGE VDLVSARGAF ALLVPARGDE APRAWFAGSL        60
     AALTVPEVIQ FVFTSLKTGV LLLAFGEDAA RAAPDTPDRL RRKSIYFRDG QVVFASSSDP       120
     SDRLGPVLLR EGLVGEEELA RCARLARAGR PLGQVLVDEG VLGPGQLYEG VTRQVREIVL       180
     GAFAELTGEF AFLEGPVDDA TAVKLPERTR ELLLAGMKRL EEAEAARAAA TTPGPGEPEV       240
     TIEIAPPEPA APARASGPFE TYRRIFRRVH AALAAVTPDA ADRLNGYLAQ LPDKRRAPFA       300
     GVHVQHDGDL DVAQVLGNVS AAGAHRGAAA RARALEALDE LLAFALFEAK NRLPREEAER       360
     LLREVGRMQV GKG                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page