(data stored in ACNUC7421 zone)

EMBL: CP000769.PE477

CP000769.PE477       Location/Qualifiers
FT   CDS             543935..544597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0482"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bja:blr5308 anti-oxidant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24697"
FT                   /db_xref="GOA:A7H7K1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K1"
FT                   /protein_id="ABS24697.1"
FT                   /translation="MPLRINDEAPNFTAQTTQGPIDFHQWIGNQWVILFSHPKDFTPVC
FT                   TTELGYMARIKPEFDRRNTKVIGLSVDSVADHARWAHDIQETQGAAPNYPIIGDADFEV
FT                   SKLYDMLPATVSGDAKARTPADNQTVRTVFLIGPDKRIKLILMYPMTTGRNFDEVLRVL
FT                   DSIQLTAKYRVATPANWHQGDDVIIAGSVSDEEARRQYPEGWRAPRPYLRFVHQPTR"
     MPLRINDEAP NFTAQTTQGP IDFHQWIGNQ WVILFSHPKD FTPVCTTELG YMARIKPEFD        60
     RRNTKVIGLS VDSVADHARW AHDIQETQGA APNYPIIGDA DFEVSKLYDM LPATVSGDAK       120
     ARTPADNQTV RTVFLIGPDK RIKLILMYPM TTGRNFDEVL RVLDSIQLTA KYRVATPANW       180
     HQGDDVIIAG SVSDEEARRQ YPEGWRAPRP YLRFVHQPTR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page