(data stored in ACNUC7421 zone)

EMBL: CP000769.PE479

CP000769.PE479       Location/Qualifiers
FT   CDS             complement(545142..545471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0484"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: mpa:MAP1641c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24699"
FT                   /db_xref="GOA:A7H7K3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K3"
FT                   /protein_id="ABS24699.1"
FT                   /translation="MFPCMPQPDVFSALANPVRRNILMQLRKGPRAVKDLAAGFDVGRP
FT                   AISEHLQVLRQARLVREEPRGRERYYHLDPRPLSEVDTWLEAFSRYWERRLVALGEVLD
FT                   KEKTR"
     MFPCMPQPDV FSALANPVRR NILMQLRKGP RAVKDLAAGF DVGRPAISEH LQVLRQARLV        60
     REEPRGRERY YHLDPRPLSE VDTWLEAFSR YWERRLVALG EVLDKEKTR                   109
//

If you have problems or comments...

PBIL Back to PBIL home page