(data stored in ACNUC7421 zone)

EMBL: CP000769.PE481

CP000769.PE481       Location/Qualifiers
FT   CDS             complement(547320..549566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0486"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   mxa:MXAN_0210 transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24701"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K5"
FT                   /protein_id="ABS24701.1"
FT                   /translation="MWATAAPAQEAEGDAPVAESQLEDLLESASRSQGVTRRYTEGDFA
FT                   PYFASGELAEAKALFDRGSHARARARLRGEQPPVRYLRAVSALRDAPASAVVELRALAD
FT                   DYPRMRDHCLFHAARALERLRKRRAAADVYAQVSPGSTLYAEARLGRSRVLERGLDLDG
FT                   ALDALVPLRELPAIPRHDAVRRKALLAAARLCQKKGDYPCEHRAMLELWATSPLSREAK
FT                   VVWERLKELPIPNRWRLRRAESFLAFHDNLEALRLARQVKTPLPDEHACTASFVIGNAL
FT                   RKERQHRKAAAELGPMVEACKSSELRPQAMYVLGYSQSVIGQDAVRTYEALAHEYPGHA
FT                   FADDALFFAAELDLRGGRRAVALERLEQVAARYATGNFAPEALFRLAWEHRTAGAHEEA
FT                   LAALDRLDRLPGLGREQRLRSRYWRARTLADKGDAAAAPAFAALAADHPAEWYGLLARA
FT                   RLPDLAPLVASHRTASSYAAATVWPLEAGPLGDDPRFLAGVELLRMQLPDGAAELLAID
FT                   RRSLPEDAARLLVEALQRSGSSAAAAYVARTTLGRTLTGGIDDRTADVWRATYPLPFRS
FT                   LVERWAKASSVDPDLLQALMREESRFNPWARSATGARGLTQLMPRTAQDVARGLKLGRV
FT                   NPGMLHRPALNIRLGAAYLAELLSEYEGSMVRAVAAYNAGPVAVWRWVRARPDEDVDVW
FT                   VEKIPITETRDYVKRVLGSYGAYRHVYGRGAGPLEDRSPRARGDRGEPKPARRL"
     MWATAAPAQE AEGDAPVAES QLEDLLESAS RSQGVTRRYT EGDFAPYFAS GELAEAKALF        60
     DRGSHARARA RLRGEQPPVR YLRAVSALRD APASAVVELR ALADDYPRMR DHCLFHAARA       120
     LERLRKRRAA ADVYAQVSPG STLYAEARLG RSRVLERGLD LDGALDALVP LRELPAIPRH       180
     DAVRRKALLA AARLCQKKGD YPCEHRAMLE LWATSPLSRE AKVVWERLKE LPIPNRWRLR       240
     RAESFLAFHD NLEALRLARQ VKTPLPDEHA CTASFVIGNA LRKERQHRKA AAELGPMVEA       300
     CKSSELRPQA MYVLGYSQSV IGQDAVRTYE ALAHEYPGHA FADDALFFAA ELDLRGGRRA       360
     VALERLEQVA ARYATGNFAP EALFRLAWEH RTAGAHEEAL AALDRLDRLP GLGREQRLRS       420
     RYWRARTLAD KGDAAAAPAF AALAADHPAE WYGLLARARL PDLAPLVASH RTASSYAAAT       480
     VWPLEAGPLG DDPRFLAGVE LLRMQLPDGA AELLAIDRRS LPEDAARLLV EALQRSGSSA       540
     AAAYVARTTL GRTLTGGIDD RTADVWRATY PLPFRSLVER WAKASSVDPD LLQALMREES       600
     RFNPWARSAT GARGLTQLMP RTAQDVARGL KLGRVNPGML HRPALNIRLG AAYLAELLSE       660
     YEGSMVRAVA AYNAGPVAVW RWVRARPDED VDVWVEKIPI TETRDYVKRV LGSYGAYRHV       720
     YGRGAGPLED RSPRARGDRG EPKPARRL                                          748
//

If you have problems or comments...

PBIL Back to PBIL home page