(data stored in ACNUC7421 zone)

EMBL: CP000769.PE483

CP000769.PE483       Location/Qualifiers
FT   CDS             complement(550979..551935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0488"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mxa:MXAN_2240 oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24703"
FT                   /db_xref="GOA:A7H7K7"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K7"
FT                   /protein_id="ABS24703.1"
FT                   /translation="MQASVPAQMRAAAFDRYGGPEVLHTETLPVPQPGPTQVLIRLDSA
FT                   GIGAWDPYLRSGEVELGPSGFPRVIGNDGAGEVVAVGDRVRGFRIGDRVYAYSFDAGFY
FT                   AEYVAVNEDEVAQIPRGLSAEEAGVLGADGVTAVRGLDDQLHLGPGQTLLVYGASGGIG
FT                   HLAVQLAKRMGARVLAVASGRDGVELVRRLGADAAVDGKRDDVARAARDFAPAGLDAAL
FT                   VLVHGESLDPALSAMRKGGRVAHPNGVEPAPTAPPGVTLLSYDGQPGRDAFEQLNRLIG
FT                   AGPFHVEIGRVYALDDAARAHREIGRHHLGKLALRIH"
     MQASVPAQMR AAAFDRYGGP EVLHTETLPV PQPGPTQVLI RLDSAGIGAW DPYLRSGEVE        60
     LGPSGFPRVI GNDGAGEVVA VGDRVRGFRI GDRVYAYSFD AGFYAEYVAV NEDEVAQIPR       120
     GLSAEEAGVL GADGVTAVRG LDDQLHLGPG QTLLVYGASG GIGHLAVQLA KRMGARVLAV       180
     ASGRDGVELV RRLGADAAVD GKRDDVARAA RDFAPAGLDA ALVLVHGESL DPALSAMRKG       240
     GRVAHPNGVE PAPTAPPGVT LLSYDGQPGR DAFEQLNRLI GAGPFHVEIG RVYALDDAAR       300
     AHREIGRHHL GKLALRIH                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page