(data stored in ACNUC7421 zone)

EMBL: CP000769.PE487

CP000769.PE487       Location/Qualifiers
FT   CDS             complement(555593..556135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0493"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: ade:Adeh_3940 Smr
FT                   protein/MutS2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24707"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L1"
FT                   /protein_id="ABS24707.1"
FT                   /translation="MTEEELWESATSGVRPLDRGPGVAAPPPPPPAAGPFWHPDLEAID
FT                   ELRALVAGDAPFDLSDTDEFIEGRAAGLDANLARKLRRGEFAVQGHVDLHGMTRDEAKG
FT                   AVEDFLRRSRQAGKRCVLVVHGRGLHSKDQLPVLKDALKTWLATGRFARHVLAFASARP
FT                   VDGGAGAIYVLLRRPGR"
     MTEEELWESA TSGVRPLDRG PGVAAPPPPP PAAGPFWHPD LEAIDELRAL VAGDAPFDLS        60
     DTDEFIEGRA AGLDANLARK LRRGEFAVQG HVDLHGMTRD EAKGAVEDFL RRSRQAGKRC       120
     VLVVHGRGLH SKDQLPVLKD ALKTWLATGR FARHVLAFAS ARPVDGGAGA IYVLLRRPGR       180
//

If you have problems or comments...

PBIL Back to PBIL home page