(data stored in ACNUC7421 zone)

EMBL: CP000769.PE488

CP000769.PE488       Location/Qualifiers
FT   CDS             556280..556462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_1091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24708"
FT                   /db_xref="InterPro:IPR017143"
FT                   /db_xref="InterPro:IPR025990"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L2"
FT                   /protein_id="ABS24708.1"
FT                   /translation="MDIEIQCPYCGEWVVVFVDPGGGAEQTYVEDCPVCCRPWIVHARE
FT                   EEPGGFAVGLARQDD"
     MDIEIQCPYC GEWVVVFVDP GGGAEQTYVE DCPVCCRPWI VHAREEEPGG FAVGLARQDD        60
//

If you have problems or comments...

PBIL Back to PBIL home page