(data stored in ACNUC7421 zone)

EMBL: CP000769.PE489

CP000769.PE489       Location/Qualifiers
FT   CDS             556577..557290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0495"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_3939 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24709"
FT                   /db_xref="GOA:A7H7L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L3"
FT                   /protein_id="ABS24709.1"
FT                   /translation="MSIVSVEHVSKDYMLGKTVVPALRDVSLSVDEGEFLSIAGPSGSG
FT                   KTTLLNLVGCVDTPTAGRVLVAGQDTARLSERALTELRLRTIGFIFQSFNLVSVLTVFQ
FT                   NVEFPLLLQGGQTRKERAERVLALLDAVGIQEHARHRPSELSGGQRQRVAIARALVTRP
FT                   ALVLADEPTANLDSETGGNIIDLMREMNRRDGTTFIFSTHDPKVMAHASALVRIEDGRL
FT                   ASREDLDGAASAGGR"
     MSIVSVEHVS KDYMLGKTVV PALRDVSLSV DEGEFLSIAG PSGSGKTTLL NLVGCVDTPT        60
     AGRVLVAGQD TARLSERALT ELRLRTIGFI FQSFNLVSVL TVFQNVEFPL LLQGGQTRKE       120
     RAERVLALLD AVGIQEHARH RPSELSGGQR QRVAIARALV TRPALVLADE PTANLDSETG       180
     GNIIDLMREM NRRDGTTFIF STHDPKVMAH ASALVRIEDG RLASREDLDG AASAGGR          237
//

If you have problems or comments...

PBIL Back to PBIL home page