(data stored in ACNUC7421 zone)

EMBL: CP000769.PE49

CP000769.PE49        Location/Qualifiers
FT   CDS             64064..64867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0049"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: ade:Adeh_0048 electron transfer
FT                   flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24269"
FT                   /db_xref="GOA:A7H6C3"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C3"
FT                   /protein_id="ABS24269.1"
FT                   /translation="MPLKILVTAKRVEDPESKIKVKPDGSGIVTDGVNYKMNPFDEIAV
FT                   EEALRLKEKHGGEVVVASIGGEKSATELRAALAMGADRGILVRHDGPLDPVVVSALLAK
FT                   VFELEKPDLVVLGKQSIDDDQNQAGQYLAARLGLAQATFASKTESLESEAEQKKQPGLA
FT                   LAADGKTLAVVREVDGGVETLEVTLPAVVTTDLRLNKPRFASLPGIMKAKKKELKELAA
FT                   ASLGVDLAPKVVVRRLSEPPARKGGVKVQDVEELWKKLHDEAKVV"
     MPLKILVTAK RVEDPESKIK VKPDGSGIVT DGVNYKMNPF DEIAVEEALR LKEKHGGEVV        60
     VASIGGEKSA TELRAALAMG ADRGILVRHD GPLDPVVVSA LLAKVFELEK PDLVVLGKQS       120
     IDDDQNQAGQ YLAARLGLAQ ATFASKTESL ESEAEQKKQP GLALAADGKT LAVVREVDGG       180
     VETLEVTLPA VVTTDLRLNK PRFASLPGIM KAKKKELKEL AAASLGVDLA PKVVVRRLSE       240
     PPARKGGVKV QDVEELWKKL HDEAKVV                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page