(data stored in ACNUC7421 zone)

EMBL: CP000769.PE491

CP000769.PE491       Location/Qualifiers
FT   CDS             559430..560737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0497"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ade:Adeh_3937 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24711"
FT                   /db_xref="GOA:A7H7L5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L5"
FT                   /protein_id="ABS24711.1"
FT                   /translation="MLGVDLQIAGRNLARHTRRNLFLGGALAAVTALLVLLGALTAGME
FT                   SSMMQSALTLMTGDVNVGGFFKVTSGSAAPLVSQYPRVLETVRATVPEVEYVTMRGRGW
FT                   AKAVSESVSMDLVLAGVDVANEPTFRSVLRVVDGDLEALAQPGTVLLFEGQAERLKVRV
FT                   NDVVTLSAPTARGVNNTADVRVAAIARNVGLLSAFSAFIQVDTLRELYGLNAATTGALH
FT                   LYLRDPGDAPRVAARLRTALADAGFRVMEPDAQPYWMKLMQTVPSEDWTGQKLDVTTAD
FT                   DEMGQFKQFILALRVVTGLLVVILMVVVVIGLLNTLAIAIRERTREIGALRAIGMQRRK
FT                   VMWLFLLESALLGALGTAAGVAVALAVAVAVNAAGIALPEAVQVFLAQERLAFLLDPRA
FT                   IVGDALLLSAITVVASIFPARRAARLKPVTAMHHVG"
     MLGVDLQIAG RNLARHTRRN LFLGGALAAV TALLVLLGAL TAGMESSMMQ SALTLMTGDV        60
     NVGGFFKVTS GSAAPLVSQY PRVLETVRAT VPEVEYVTMR GRGWAKAVSE SVSMDLVLAG       120
     VDVANEPTFR SVLRVVDGDL EALAQPGTVL LFEGQAERLK VRVNDVVTLS APTARGVNNT       180
     ADVRVAAIAR NVGLLSAFSA FIQVDTLREL YGLNAATTGA LHLYLRDPGD APRVAARLRT       240
     ALADAGFRVM EPDAQPYWMK LMQTVPSEDW TGQKLDVTTA DDEMGQFKQF ILALRVVTGL       300
     LVVILMVVVV IGLLNTLAIA IRERTREIGA LRAIGMQRRK VMWLFLLESA LLGALGTAAG       360
     VAVALAVAVA VNAAGIALPE AVQVFLAQER LAFLLDPRAI VGDALLLSAI TVVASIFPAR       420
     RAARLKPVTA MHHVG                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page