(data stored in ACNUC7421 zone)

EMBL: CP000769.PE492

CP000769.PE492       Location/Qualifiers
FT   CDS             560746..561522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24712"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L6"
FT                   /protein_id="ABS24712.1"
FT                   /translation="MHRVPLVTAALALLASAAPALALTAPELAKVVATIDERQRNSGDW
FT                   KALCYMEAKEKGKTDVVYELVVYRRDEDDKQMFLFTKPRAEAGKGYLRIDKNLWLYDPA
FT                   VGRWERRTERERIGGTDTRRGDLDESRLVEEYDATFEADEKLGAYDVHRILLVVKPGVD
FT                   VAFPKVRLWVDRATLNVLKRQELALSGRLMRTAYYPRWKKLFSPSKRADVWYPEEMRIF
FT                   DEIEKGNSTLILIKEIDLRPLAANLFTKAWLESKSR"
     MHRVPLVTAA LALLASAAPA LALTAPELAK VVATIDERQR NSGDWKALCY MEAKEKGKTD        60
     VVYELVVYRR DEDDKQMFLF TKPRAEAGKG YLRIDKNLWL YDPAVGRWER RTERERIGGT       120
     DTRRGDLDES RLVEEYDATF EADEKLGAYD VHRILLVVKP GVDVAFPKVR LWVDRATLNV       180
     LKRQELALSG RLMRTAYYPR WKKLFSPSKR ADVWYPEEMR IFDEIEKGNS TLILIKEIDL       240
     RPLAANLFTK AWLESKSR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page