(data stored in ACNUC7421 zone)

EMBL: CP000769.PE498

CP000769.PE498       Location/Qualifiers
FT   CDS             complement(571240..571731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24718"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M2"
FT                   /protein_id="ABS24718.1"
FT                   /translation="MTRDEKVRALREKARVLYEGKEVAHRSCGVALAETFGRDPRPYLT
FT                   LRRGGLTGEGLCGAVLAGQLVLGELLGGDDFTAPAPPALREALERYRAAVAARLRTGGA
FT                   ESLVCNALVGRFPIFQSEERAAFCTDIAATVAEIVAEIAVDLGAEVEVTAMRPSTPLRG
FT                   "
     MTRDEKVRAL REKARVLYEG KEVAHRSCGV ALAETFGRDP RPYLTLRRGG LTGEGLCGAV        60
     LAGQLVLGEL LGGDDFTAPA PPALREALER YRAAVAARLR TGGAESLVCN ALVGRFPIFQ       120
     SEERAAFCTD IAATVAEIVA EIAVDLGAEV EVTAMRPSTP LRG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page