(data stored in ACNUC7421 zone)

EMBL: CP000769.PE504

CP000769.PE504       Location/Qualifiers
FT   CDS             complement(578194..578877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0510"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: ade:Adeh_3914 bifunctional
FT                   deaminase-reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24724"
FT                   /db_xref="GOA:A7H7M8"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M8"
FT                   /protein_id="ABS24724.1"
FT                   /translation="MSRLRINSFAISIDGYGAGPGQSLDHPMGVGGMALHQWVLGTKTF
FT                   QRMHADFAGSLIGDEVAREDVDDAFAARGFENVGAWILGRNMFGPVRGPWPDDGWKGWW
FT                   GSNPPYHVPVFVLTHHARAPIEMEGGTTFHFVTDGIHAALERAREAARGKDVRLGGGVA
FT                   TIRQYLTAGLIDELHLAISPVLLGRGEHLLAGIDTVSLGYTCTEHASTDLATHVVLTRS
FT                   PRNPR"
     MSRLRINSFA ISIDGYGAGP GQSLDHPMGV GGMALHQWVL GTKTFQRMHA DFAGSLIGDE        60
     VAREDVDDAF AARGFENVGA WILGRNMFGP VRGPWPDDGW KGWWGSNPPY HVPVFVLTHH       120
     ARAPIEMEGG TTFHFVTDGI HAALERAREA ARGKDVRLGG GVATIRQYLT AGLIDELHLA       180
     ISPVLLGRGE HLLAGIDTVS LGYTCTEHAS TDLATHVVLT RSPRNPR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page