(data stored in ACNUC7421 zone)

EMBL: CP000769.PE506

CP000769.PE506       Location/Qualifiers
FT   CDS             complement(579382..579756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0512"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   rha:RHA1_ro08705 probable transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24726"
FT                   /db_xref="GOA:A7H7N0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N0"
FT                   /protein_id="ABS24726.1"
FT                   /translation="MPIWVYVSPGMARAATTTDAWNAVAEPQRRRILTLLRGGEQPVTE
FT                   LARALRMDQPRASKHLRVLREVGLVRVREQGRQRLYALDARGLRPIHEWVGGFERFWNE
FT                   SFARLDAFVQELAEQEERKR"
     MPIWVYVSPG MARAATTTDA WNAVAEPQRR RILTLLRGGE QPVTELARAL RMDQPRASKH        60
     LRVLREVGLV RVREQGRQRL YALDARGLRP IHEWVGGFER FWNESFARLD AFVQELAEQE       120
     ERKR                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page