(data stored in ACNUC7421 zone)

EMBL: CP000769.PE509

CP000769.PE509       Location/Qualifiers
FT   CDS             complement(581737..582759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0515"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: ade:Adeh_0473
FT                   hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24729"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N3"
FT                   /protein_id="ABS24729.1"
FT                   /translation="MDKPVAKIGLKHGSGGRAMRQLIEDVFLTLASPVDGIGLSALDDG
FT                   AAIRVGDRWLVVTTDSHVVHPIFFPGGDIGRLSVSGTVNDLAMMGATEPLGLTCAVVLE
FT                   DGFPRADLERVVASMRETAREANAPIVTGDTKVMGKDEVDGIVLNTTGVALAERVVSDA
FT                   GLRAGDLLIVTGTIGDHGMAIMSRRHDLRLEGDLRSDVAPLNGLVREALRAGGEDVVAM
FT                   KDPTRGGVAGVLHEMAAKGKVGIVIDETALPVRDEVRAAGEMIGIDPLLVANEGKAVIA
FT                   VRARAADKVLAALRAHPLGASATVIATAIAERPGAVILDTGFGKRMLAEPEGELLPRIC
FT                   "
     MDKPVAKIGL KHGSGGRAMR QLIEDVFLTL ASPVDGIGLS ALDDGAAIRV GDRWLVVTTD        60
     SHVVHPIFFP GGDIGRLSVS GTVNDLAMMG ATEPLGLTCA VVLEDGFPRA DLERVVASMR       120
     ETAREANAPI VTGDTKVMGK DEVDGIVLNT TGVALAERVV SDAGLRAGDL LIVTGTIGDH       180
     GMAIMSRRHD LRLEGDLRSD VAPLNGLVRE ALRAGGEDVV AMKDPTRGGV AGVLHEMAAK       240
     GKVGIVIDET ALPVRDEVRA AGEMIGIDPL LVANEGKAVI AVRARAADKV LAALRAHPLG       300
     ASATVIATAI AERPGAVILD TGFGKRMLAE PEGELLPRIC                             340
//

If you have problems or comments...

PBIL Back to PBIL home page