(data stored in ACNUC7421 zone)

EMBL: CP000769.PE51

CP000769.PE51        Location/Qualifiers
FT   CDS             65882..66886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0051"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ade:Adeh_0050 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24271"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C5"
FT                   /protein_id="ABS24271.1"
FT                   /translation="MTEADLAALGVHRIAVPIPFPQAGGPVNVYAIEEAGGGLVLFDSG
FT                   FSSAEAHAALEDGFRRIGRRFDEVTRIVVSHGHVDHYGGARHVQELHGGTPPVYAHPAD
FT                   LPKVTEEGWRWREHAPAYAAHLARLGLPEDVIAATAAAGEKSFELAPRVPEARPLAEGE
FT                   RLRARHLDLEVLHMPGHTPGLVCLYDRARRLFLSDDHLLQKISPNPLIELGPHGEEGYF
FT                   RPLLAYLDSVRRLHALDVDLVLPGHGPPFSGHRAVIDRLVEFYGKRQARLRELLAAGPR
FT                   TAWELCRTLFPWAKPAEAFLTISETAANLELLEARGEVARTEVAGRWSYALAR"
     MTEADLAALG VHRIAVPIPF PQAGGPVNVY AIEEAGGGLV LFDSGFSSAE AHAALEDGFR        60
     RIGRRFDEVT RIVVSHGHVD HYGGARHVQE LHGGTPPVYA HPADLPKVTE EGWRWREHAP       120
     AYAAHLARLG LPEDVIAATA AAGEKSFELA PRVPEARPLA EGERLRARHL DLEVLHMPGH       180
     TPGLVCLYDR ARRLFLSDDH LLQKISPNPL IELGPHGEEG YFRPLLAYLD SVRRLHALDV       240
     DLVLPGHGPP FSGHRAVIDR LVEFYGKRQA RLRELLAAGP RTAWELCRTL FPWAKPAEAF       300
     LTISETAANL ELLEARGEVA RTEVAGRWSY ALAR                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page