(data stored in ACNUC7421 zone)

EMBL: CP000769.PE519

CP000769.PE519       Location/Qualifiers
FT   CDS             complement(593372..594322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0525"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ade:Adeh_0480 Fe-S-cluster-containing
FT                   hydrogenase components 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24739"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P3"
FT                   /protein_id="ABS24739.1"
FT                   /translation="MAITRRDLLKGAAVAGAATALAGKAEAREAVQPLPDAVGMLFDAT
FT                   RCVGCRACVTRCKEANELPYDRTPDGQYDAPNDLNGTTKNIIKAHPAGDSQTYMKQQCM
FT                   HCVDPSCVSVCMMGALHKEAQGKRLMKGERSVATGIVLWDKDLCVGCRYCQIGCAFNVP
FT                   KFEWDDAFPKIVKCELCRHRGDPKKEGPLAVANPACCEACPREAVIYGRRAELLAEAKR
FT                   RVAAEPERYEAKVYGEHDGGGTQVLYLAPKGVEFTALGLPVLPERSSAEFSEKVSHAPY
FT                   LHGLTPIALYAGLAFVIHRNRKKEEAAEHGPEGKR"
     MAITRRDLLK GAAVAGAATA LAGKAEAREA VQPLPDAVGM LFDATRCVGC RACVTRCKEA        60
     NELPYDRTPD GQYDAPNDLN GTTKNIIKAH PAGDSQTYMK QQCMHCVDPS CVSVCMMGAL       120
     HKEAQGKRLM KGERSVATGI VLWDKDLCVG CRYCQIGCAF NVPKFEWDDA FPKIVKCELC       180
     RHRGDPKKEG PLAVANPACC EACPREAVIY GRRAELLAEA KRRVAAEPER YEAKVYGEHD       240
     GGGTQVLYLA PKGVEFTALG LPVLPERSSA EFSEKVSHAP YLHGLTPIAL YAGLAFVIHR       300
     NRKKEEAAEH GPEGKR                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page