(data stored in ACNUC7421 zone)

EMBL: CP000769.PE520

CP000769.PE520       Location/Qualifiers
FT   CDS             complement(594329..595510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0526"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   Nickel-iron dehydrogenase small subunit domain protein;
FT                   KEGG: ade:Adeh_0481 hydrogenase (NiFe) small subunit
FT                   (HydA)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24740"
FT                   /db_xref="GOA:A7H7P4"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P4"
FT                   /protein_id="ABS24740.1"
FT                   /translation="MLQFKTGAVVFAHPEDGMNDMRSEVLGLGTAKGVSRRDFIKVCTT
FT                   AAAAVGLPAWAGEKMAENVAKGRKPSVIWLHFQECTGCTESLLRTSHPDVGSLILDLVS
FT                   VDYHETLFAAAGLQIEEALEKAMHENEGKFVLVVEGAIPTKDGGIYCQVGGKKAVDTLS
FT                   EVAAKAGAVIAIGSCASWGGIPSAEPNPTGATGVPQLLKGKSVVTLPGCPANPYNLLGT
FT                   VLQYATFGTLPALDDLGRPKFAYGRVIHEDCQRRPHFDAGRFAQAFGDEGHRNGWCLYK
FT                   LGCKGPQTHANCSLLDFCEVPGAWPVAIGHPCVGCTEQGIGFHVPIYTNLPVERPTAPM
FT                   AYPAVHPDHDVLGRGNGAIAIGVGSAIAGAVIGAGVMATRKLTAEAEKEEGKE"
     MLQFKTGAVV FAHPEDGMND MRSEVLGLGT AKGVSRRDFI KVCTTAAAAV GLPAWAGEKM        60
     AENVAKGRKP SVIWLHFQEC TGCTESLLRT SHPDVGSLIL DLVSVDYHET LFAAAGLQIE       120
     EALEKAMHEN EGKFVLVVEG AIPTKDGGIY CQVGGKKAVD TLSEVAAKAG AVIAIGSCAS       180
     WGGIPSAEPN PTGATGVPQL LKGKSVVTLP GCPANPYNLL GTVLQYATFG TLPALDDLGR       240
     PKFAYGRVIH EDCQRRPHFD AGRFAQAFGD EGHRNGWCLY KLGCKGPQTH ANCSLLDFCE       300
     VPGAWPVAIG HPCVGCTEQG IGFHVPIYTN LPVERPTAPM AYPAVHPDHD VLGRGNGAIA       360
     IGVGSAIAGA VIGAGVMATR KLTAEAEKEE GKE                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page