(data stored in ACNUC7421 zone)

EMBL: CP000769.PE522

CP000769.PE522       Location/Qualifiers
FT   CDS             597368..599050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0528"
FT                   /product="MutT/NUDIX family protein"
FT                   /note="KEGG: ade:Adeh_0483 MutT/NUDIX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24742"
FT                   /db_xref="InterPro:IPR039461"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P6"
FT                   /protein_id="ABS24742.1"
FT                   /translation="MRIFARSLAAALAFAALPADAASAARFPDAAALRRAEARYAPVDL
FT                   KVDVSRLPESERRALALLVEAARVMDALFLRQAWAGNEPLLLVLAQDRSPLGQARLAAF
FT                   LRNKGPWDRLEHGEPAFLPGVPEKPAAANFYPAGATKEEVERWLAGLAPEAKAEATGFF
FT                   TTVRRAPGGGLVAVPYALEYQGDLARAAELLRAAAAATSDATLRKFLEARAQAFTSNDY
FT                   YASDVAWMELDASVEPTIGPYEVYEDGWFNAKAAFEAFIGVRDDAETAKLQRFAAELQG
FT                   IEDALPIDAALKNPKLGAMAPIRVVNELLAAGDAMKGVQTAAFNLPNDERIVREMGSKR
FT                   VMLKNVQEAKFQRVLLPIAGIALSKADRAAVAFDPFFTHILMHELLHGLGPHELVLGGR
FT                   TTTVRAELGDTYSALEEAKADVAGLFALQKLLDEGKLDRGMQRTLYPTFLASAFRSIRF
FT                   GVGEAHGRGMALQLSWFLDAGAIAPRPDGSFAIDAAKMREAVVSLTREIMTIQGKGDRA
FT                   AAQALLEQKGVVRPEVQRVLDRLRGIPVDIAPRFVTAEALTQR"
     MRIFARSLAA ALAFAALPAD AASAARFPDA AALRRAEARY APVDLKVDVS RLPESERRAL        60
     ALLVEAARVM DALFLRQAWA GNEPLLLVLA QDRSPLGQAR LAAFLRNKGP WDRLEHGEPA       120
     FLPGVPEKPA AANFYPAGAT KEEVERWLAG LAPEAKAEAT GFFTTVRRAP GGGLVAVPYA       180
     LEYQGDLARA AELLRAAAAA TSDATLRKFL EARAQAFTSN DYYASDVAWM ELDASVEPTI       240
     GPYEVYEDGW FNAKAAFEAF IGVRDDAETA KLQRFAAELQ GIEDALPIDA ALKNPKLGAM       300
     APIRVVNELL AAGDAMKGVQ TAAFNLPNDE RIVREMGSKR VMLKNVQEAK FQRVLLPIAG       360
     IALSKADRAA VAFDPFFTHI LMHELLHGLG PHELVLGGRT TTVRAELGDT YSALEEAKAD       420
     VAGLFALQKL LDEGKLDRGM QRTLYPTFLA SAFRSIRFGV GEAHGRGMAL QLSWFLDAGA       480
     IAPRPDGSFA IDAAKMREAV VSLTREIMTI QGKGDRAAAQ ALLEQKGVVR PEVQRVLDRL       540
     RGIPVDIAPR FVTAEALTQR                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page