(data stored in ACNUC7421 zone)

EMBL: CP000769.PE529

CP000769.PE529       Location/Qualifiers
FT   CDS             complement(608606..610810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0535"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: ade:Adeh_3599 fimbrial biogenesis outer
FT                   membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24749"
FT                   /db_xref="GOA:A7H7Q3"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q3"
FT                   /protein_id="ABS24749.1"
FT                   /translation="MNGVPGDTALVLIAPRDAWISPADLARTGLSGIGGARRELDGRTL
FT                   VSLRSLAPDVRFELDERELALRLEAAPSLLGRGAVDLRAWSRPAGIETGDAPSAFLNYA
FT                   AHATTQEDASGFLEAGVSRDAALLTGSVSATQVAGVVRGLTTLTLDRPERLLRLTAGDA
FT                   LVAPDALSGAPMLAGIGIAREWSLDPYRVRAPLPGATAFAATPSTVDVYVNGALARSLP
FT                   VAPGTYDLSNLPVTTGANDVRLVVRDAFGRTQAIEAAHYQAQGLLAPGLDELGWWAGAL
FT                   RERYGTESFSYGDPVLIGRHRRGFSDRLTGGARLELGPRVQQAGASVTVGSGAGELEAA
FT                   AAASADEGAPGAAGFLAWRYSARRFALGADASVLSSRFAHATLAAGADRALWRAGAHVA
FT                   APLGRVASVELQYVGAEQRDAGASHRVEARTSLRVGGGAWLQLSASVSRDRAADPAAAV
FT                   FAQLVMAAPGGGTLDAGVRSGRAGTSASTGLQRTLPVGPGVGYRLRADSAAGGTVSALA
FT                   QAQPEFGRYELGYDHGRGSEVGSASASGGLVLVGRRLFATRPVEQGFALLRVPGVPGVR
FT                   AYLDRRPVGRTDARGDLLVPGLLPYYGNRLGIEDADVPASYRIGDTERLVASRPRGAAV
FT                   VRFDVERLRAVEGWLRLARREGAVVPAYGTFELDLPGGTRRSPVGADGAFWLEDVPAGE
FT                   HAARVYWNGEVCELPLAVPESGAGVLELGTVTCGPRAPML"
     MNGVPGDTAL VLIAPRDAWI SPADLARTGL SGIGGARREL DGRTLVSLRS LAPDVRFELD        60
     ERELALRLEA APSLLGRGAV DLRAWSRPAG IETGDAPSAF LNYAAHATTQ EDASGFLEAG       120
     VSRDAALLTG SVSATQVAGV VRGLTTLTLD RPERLLRLTA GDALVAPDAL SGAPMLAGIG       180
     IAREWSLDPY RVRAPLPGAT AFAATPSTVD VYVNGALARS LPVAPGTYDL SNLPVTTGAN       240
     DVRLVVRDAF GRTQAIEAAH YQAQGLLAPG LDELGWWAGA LRERYGTESF SYGDPVLIGR       300
     HRRGFSDRLT GGARLELGPR VQQAGASVTV GSGAGELEAA AAASADEGAP GAAGFLAWRY       360
     SARRFALGAD ASVLSSRFAH ATLAAGADRA LWRAGAHVAA PLGRVASVEL QYVGAEQRDA       420
     GASHRVEART SLRVGGGAWL QLSASVSRDR AADPAAAVFA QLVMAAPGGG TLDAGVRSGR       480
     AGTSASTGLQ RTLPVGPGVG YRLRADSAAG GTVSALAQAQ PEFGRYELGY DHGRGSEVGS       540
     ASASGGLVLV GRRLFATRPV EQGFALLRVP GVPGVRAYLD RRPVGRTDAR GDLLVPGLLP       600
     YYGNRLGIED ADVPASYRIG DTERLVASRP RGAAVVRFDV ERLRAVEGWL RLARREGAVV       660
     PAYGTFELDL PGGTRRSPVG ADGAFWLEDV PAGEHAARVY WNGEVCELPL AVPESGAGVL       720
     ELGTVTCGPR APML                                                         734
//

If you have problems or comments...

PBIL Back to PBIL home page