(data stored in ACNUC7421 zone)

EMBL: CP000769.PE53

CP000769.PE53        Location/Qualifiers
FT   CDS             67705..68607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0053"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ade:Adeh_0052 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24273"
FT                   /db_xref="GOA:A7H6C7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C7"
FT                   /protein_id="ABS24273.1"
FT                   /translation="MADLALLVLTLFWGTTFHFVKGVLEVASPGVFLAARFATAAAVLG
FT                   AVALWRRERVGAGFLRHGVLLGAFMLAGFALQTVGLRHTTPARSGFFTGLAVLIVPFLA
FT                   RFLLGRAVKMASWAGVALAVAGLALLTHPFGEPVDAGVRLGDLLTAGCAVAFALQIVYT
FT                   SEWSPRHPIVPLTLAQITVTFLGAAAMLPFESRYYRPEGAAVFAVTVVFTGVFMTALAF
FT                   FVQNWGQRHTTAVRAALIFSLEPVAAALFSHFYGGEPLRATDWGGGALIALGVVAGEVG
FT                   GLVEGRRSPGPALTAGGRG"
     MADLALLVLT LFWGTTFHFV KGVLEVASPG VFLAARFATA AAVLGAVALW RRERVGAGFL        60
     RHGVLLGAFM LAGFALQTVG LRHTTPARSG FFTGLAVLIV PFLARFLLGR AVKMASWAGV       120
     ALAVAGLALL THPFGEPVDA GVRLGDLLTA GCAVAFALQI VYTSEWSPRH PIVPLTLAQI       180
     TVTFLGAAAM LPFESRYYRP EGAAVFAVTV VFTGVFMTAL AFFVQNWGQR HTTAVRAALI       240
     FSLEPVAAAL FSHFYGGEPL RATDWGGGAL IALGVVAGEV GGLVEGRRSP GPALTAGGRG       300
//

If you have problems or comments...

PBIL Back to PBIL home page