(data stored in ACNUC7421 zone)

EMBL: CP000769.PE535

CP000769.PE535       Location/Qualifiers
FT   CDS             620978..621814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0541"
FT                   /product="Protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   ava:Ava_4781 MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24755"
FT                   /db_xref="GOA:A7H7Q9"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q9"
FT                   /protein_id="ABS24755.1"
FT                   /translation="MRTGADEDAAERGELEALLEAIHRRYGHDFRGYARSSVARRLREV
FT                   LRAERAGSFSELQALVLRDPAAMERMLSTLCVHVTSMFRDPTFYLALRQKVLPALRRAP
FT                   LIRVWHAGCASGEEAYSAAILLDEEGLLERSRIYATDLAPAALETARAGVYPADLVQEY
FT                   TANYLRAGGQRSLSDHYVARYDSVILKERLRRRIVFSRHDLVTGDVFNDFHLVLCRNVL
FT                   IYFEPPLQGRVHRLLLASLRGGGFLGLGRSEALPPDLRDRYEELDAREHLYRRREP"
     MRTGADEDAA ERGELEALLE AIHRRYGHDF RGYARSSVAR RLREVLRAER AGSFSELQAL        60
     VLRDPAAMER MLSTLCVHVT SMFRDPTFYL ALRQKVLPAL RRAPLIRVWH AGCASGEEAY       120
     SAAILLDEEG LLERSRIYAT DLAPAALETA RAGVYPADLV QEYTANYLRA GGQRSLSDHY       180
     VARYDSVILK ERLRRRIVFS RHDLVTGDVF NDFHLVLCRN VLIYFEPPLQ GRVHRLLLAS       240
     LRGGGFLGLG RSEALPPDLR DRYEELDARE HLYRRREP                               278
//

If you have problems or comments...

PBIL Back to PBIL home page