(data stored in ACNUC7421 zone)

EMBL: CP000769.PE536

CP000769.PE536       Location/Qualifiers
FT   CDS             complement(621818..622483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24756"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R0"
FT                   /protein_id="ABS24756.1"
FT                   /translation="MRFPRALAVLGAVIVFAGCPDTTRTPFDPADGFQPIEPCTAAFPP
FT                   ATAGDPHPEEIQIVSDWREGRLAYAHGAGYLHATLPEVLEALRDPRVSRIHQTDSWDVT
FT                   PNVEPEYPISFSIRYAAGPAIYKGRWTILYRGGALLGTVEAPQQLGFRYQKVEGIEDIR
FT                   VQSGSLVAYDAGDGVTALELVCHLDTSSRADQGPEDVHGTVNDWFVGLRAKVHGAPVP"
     MRFPRALAVL GAVIVFAGCP DTTRTPFDPA DGFQPIEPCT AAFPPATAGD PHPEEIQIVS        60
     DWREGRLAYA HGAGYLHATL PEVLEALRDP RVSRIHQTDS WDVTPNVEPE YPISFSIRYA       120
     AGPAIYKGRW TILYRGGALL GTVEAPQQLG FRYQKVEGIE DIRVQSGSLV AYDAGDGVTA       180
     LELVCHLDTS SRADQGPEDV HGTVNDWFVG LRAKVHGAPV P                           221
//

If you have problems or comments...

PBIL Back to PBIL home page