(data stored in ACNUC7421 zone)

EMBL: CP000769.PE537

CP000769.PE537       Location/Qualifiers
FT   CDS             622635..623309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24757"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R1"
FT                   /protein_id="ABS24757.1"
FT                   /translation="MRKLLSLTIALAVLAGCGDDDDGGGGPALTGKLHGETFDPAEVVF
FT                   AGPRQSASCEFPGFPITYGIGDALIAFSPEAGGGCALADPCAGRRSFTFVAGLLAHAEV
FT                   PAPAAAPALDGGSYAVYGSLDEAVPALATSGGGSIRTALLAAQQTDAQCAPVAAPPSAS
FT                   GTIRLDAVSATELRGQIDVSFADGQGGFLRGQFTARPCPAVTFDACFSDAGLTCSGTPS
FT                   CQ"
     MRKLLSLTIA LAVLAGCGDD DDGGGGPALT GKLHGETFDP AEVVFAGPRQ SASCEFPGFP        60
     ITYGIGDALI AFSPEAGGGC ALADPCAGRR SFTFVAGLLA HAEVPAPAAA PALDGGSYAV       120
     YGSLDEAVPA LATSGGGSIR TALLAAQQTD AQCAPVAAPP SASGTIRLDA VSATELRGQI       180
     DVSFADGQGG FLRGQFTARP CPAVTFDACF SDAGLTCSGT PSCQ                        224
//

If you have problems or comments...

PBIL Back to PBIL home page