(data stored in ACNUC7421 zone)

EMBL: CP000769.PE539

CP000769.PE539       Location/Qualifiers
FT   CDS             624243..625250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0545"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   ade:Adeh_0200 cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24759"
FT                   /db_xref="GOA:A7H7R3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R3"
FT                   /protein_id="ABS24759.1"
FT                   /translation="MPTRAVAERRARWFVCRMRAFTRFAWAVLGYNLLVVAWGAFVRAT
FT                   GSGAGCGKHWPMCNGAVVPRAPAVETVIEFTHRATSGIALLLVVALVAWAVRAFPGGHP
FT                   ARKAAWASLGLMILEALVGAGLVLFGWVAKDTSFARGWVMGVHLTNTFLLLGALTLTAD
FT                   WSARPGGMRFGERGVVAGALWLAFVTVILAGVTGAIAALGDTLFPTTSFAEGLRQELST
FT                   EAHVLLRLRILHPFAAVAAAAVLLLVARMALRHRPDPRVRRAALSLLLLVAIELLAGAV
FT                   NVLLLAPVWLQLVHLLLADLVFVSLVLLAAASLAPGEVEVPAGTPGPLPASLQS"
     MPTRAVAERR ARWFVCRMRA FTRFAWAVLG YNLLVVAWGA FVRATGSGAG CGKHWPMCNG        60
     AVVPRAPAVE TVIEFTHRAT SGIALLLVVA LVAWAVRAFP GGHPARKAAW ASLGLMILEA       120
     LVGAGLVLFG WVAKDTSFAR GWVMGVHLTN TFLLLGALTL TADWSARPGG MRFGERGVVA       180
     GALWLAFVTV ILAGVTGAIA ALGDTLFPTT SFAEGLRQEL STEAHVLLRL RILHPFAAVA       240
     AAAVLLLVAR MALRHRPDPR VRRAALSLLL LVAIELLAGA VNVLLLAPVW LQLVHLLLAD       300
     LVFVSLVLLA AASLAPGEVE VPAGTPGPLP ASLQS                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page