(data stored in ACNUC7421 zone)

EMBL: CP000769.PE541

CP000769.PE541       Location/Qualifiers
FT   CDS             626308..627264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24761"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R5"
FT                   /protein_id="ABS24761.1"
FT                   /translation="MRDHIAWPELPLARWRGTCETLHMWTQVIGKVRLASTPLVNHWWN
FT                   VPLYPTARGLTTSLMFHGPTGFEIALDLLDHQLEVTTSDGTFGAMPLVPQTVAQFHARL
FT                   MGMLRDLAIDVPIRTTPVEIPNPIPFEKDDVHASYDAEWAQRFWRVLLASSRVLGEFRA
FT                   RFIGKASPVHFFWGSFDLAVTLFSGRRAPERPGADGITREAYSHEVVSFGFWPGGGVMD
FT                   DAAFYAYAAPEPAAFADAPVRPAEAHYHRALREFILPYAAVRADAEPERRLMEFLETTY
FT                   EAATELGGWDRAALERGEPAAVEAAPRGERPEAPPLH"
     MRDHIAWPEL PLARWRGTCE TLHMWTQVIG KVRLASTPLV NHWWNVPLYP TARGLTTSLM        60
     FHGPTGFEIA LDLLDHQLEV TTSDGTFGAM PLVPQTVAQF HARLMGMLRD LAIDVPIRTT       120
     PVEIPNPIPF EKDDVHASYD AEWAQRFWRV LLASSRVLGE FRARFIGKAS PVHFFWGSFD       180
     LAVTLFSGRR APERPGADGI TREAYSHEVV SFGFWPGGGV MDDAAFYAYA APEPAAFADA       240
     PVRPAEAHYH RALREFILPY AAVRADAEPE RRLMEFLETT YEAATELGGW DRAALERGEP       300
     AAVEAAPRGE RPEAPPLH                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page