(data stored in ACNUC7421 zone)

EMBL: CP000769.PE546

CP000769.PE546       Location/Qualifiers
FT   CDS             complement(631662..632660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0552"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   ade:Adeh_2249 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24766"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S0"
FT                   /protein_id="ABS24766.1"
FT                   /translation="MEPRVWRFVKTLLAAVAAAALLAPASPRAAYPERPITMIVPFAAG
FT                   GPTDVVARIVADDMSRTLGQQIVIENVAGAGGTTGITRASQAPPDGYTIMMGHMGTHGA
FT                   APAVYPNLKYDPVKDFAPIGLASGTPILIVARKDFPAKDLKEFMAYAKQNGSKLNEAHA
FT                   GVGSVSFSTCTVFNSLVGVKPTRVVYRGTGPALNDLVAGQVDYMCDQIPSLVPQIQAGT
FT                   IKAYAVALPERSPALPNVPTTKEAGLPEFQVSAWNAIFAPKGTPPEVTKKLNGALVKAL
FT                   KDPGTRKRLLDLGGDLSNEDAQTPEGLRKLVESEVARWSKALKGAGSAEAK"
     MEPRVWRFVK TLLAAVAAAA LLAPASPRAA YPERPITMIV PFAAGGPTDV VARIVADDMS        60
     RTLGQQIVIE NVAGAGGTTG ITRASQAPPD GYTIMMGHMG THGAAPAVYP NLKYDPVKDF       120
     APIGLASGTP ILIVARKDFP AKDLKEFMAY AKQNGSKLNE AHAGVGSVSF STCTVFNSLV       180
     GVKPTRVVYR GTGPALNDLV AGQVDYMCDQ IPSLVPQIQA GTIKAYAVAL PERSPALPNV       240
     PTTKEAGLPE FQVSAWNAIF APKGTPPEVT KKLNGALVKA LKDPGTRKRL LDLGGDLSNE       300
     DAQTPEGLRK LVESEVARWS KALKGAGSAE AK                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page