(data stored in ACNUC7421 zone)

EMBL: CP000769.PE547

CP000769.PE547       Location/Qualifiers
FT   CDS             complement(632695..634197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0553"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: ade:Adeh_2248 protein of unknown
FT                   function DUF112, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24767"
FT                   /db_xref="GOA:A7H7S1"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S1"
FT                   /protein_id="ABS24767.1"
FT                   /translation="MSDLFQHLALGFSVALSAQNLLLALTGCFVGTLVGVLPGVGPIAT
FT                   ITMLLPVTFGLDPVGAIIMLAGIYYGAQYGGSTTAILVNIPGEVTAVVTTLDGHEMAKQ
FT                   GRAGAALGVAALGSFFAGCVATLVVAAAAVPLTRVALLFGSAEYFSLMAAGLVFAIVLA
FT                   RGSLLKAIGMILVGLLLSTVGTDLETGVERMTFGYAPLADGLDFAVLAMGIFGLAEVLR
FT                   NLEVTEHRDVVKRPIGRVLPSMAELRQSARPIVRGSLLGSALGVLPGNGAVLGPFASYA
FT                   LEKKLAKDPRRFGRGAIEGVAGPESANNAGAQTSFIPLLALGIPPNAVMALMVGAMTIH
FT                   GIVPGPLVMTRNPSLFWGVVASMWIGNLMLLVINLPLVGVWVRLVKVPYRLMYPAILVF
FT                   SCIGIYSVNNSPADVLFTAGLAVIGWALTKLGFETAPLLLGYVLGRLMEENLRRALAIA
FT                   RGDPAVFVQRPVSAALLAVAALVLILAVVPSLRKKRDEVFVE"
     MSDLFQHLAL GFSVALSAQN LLLALTGCFV GTLVGVLPGV GPIATITMLL PVTFGLDPVG        60
     AIIMLAGIYY GAQYGGSTTA ILVNIPGEVT AVVTTLDGHE MAKQGRAGAA LGVAALGSFF       120
     AGCVATLVVA AAAVPLTRVA LLFGSAEYFS LMAAGLVFAI VLARGSLLKA IGMILVGLLL       180
     STVGTDLETG VERMTFGYAP LADGLDFAVL AMGIFGLAEV LRNLEVTEHR DVVKRPIGRV       240
     LPSMAELRQS ARPIVRGSLL GSALGVLPGN GAVLGPFASY ALEKKLAKDP RRFGRGAIEG       300
     VAGPESANNA GAQTSFIPLL ALGIPPNAVM ALMVGAMTIH GIVPGPLVMT RNPSLFWGVV       360
     ASMWIGNLML LVINLPLVGV WVRLVKVPYR LMYPAILVFS CIGIYSVNNS PADVLFTAGL       420
     AVIGWALTKL GFETAPLLLG YVLGRLMEEN LRRALAIARG DPAVFVQRPV SAALLAVAAL       480
     VLILAVVPSL RKKRDEVFVE                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page