(data stored in ACNUC7421 zone)

EMBL: CP000769.PE548

CP000769.PE548       Location/Qualifiers
FT   CDS             complement(634205..634714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0554"
FT                   /product="protein of unknown function DUF1468"
FT                   /note="PFAM: protein of unknown function DUF1468; KEGG:
FT                   ade:Adeh_2247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24768"
FT                   /db_xref="GOA:A7H7S2"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S2"
FT                   /protein_id="ABS24768.1"
FT                   /translation="MPERAADVSRGAVTPGGPRVQAPQNLAAGASLVALALFAWWAGAE
FT                   LETGTLRSMGPGMLPRAVTVLVGLTGLALVVLSLVKEGDPLGRWPLRGPFFVALAVVAF
FT                   ALSIRTVGLALAGPLVALVSGAASPETRWKELVVFAIVITAFCIGLFRYALHLPIPILV
FT                   LPGFVI"
     MPERAADVSR GAVTPGGPRV QAPQNLAAGA SLVALALFAW WAGAELETGT LRSMGPGMLP        60
     RAVTVLVGLT GLALVVLSLV KEGDPLGRWP LRGPFFVALA VVAFALSIRT VGLALAGPLV       120
     ALVSGAASPE TRWKELVVFA IVITAFCIGL FRYALHLPIP ILVLPGFVI                   169
//

If you have problems or comments...

PBIL Back to PBIL home page