(data stored in ACNUC7421 zone)

EMBL: CP000769.PE55

CP000769.PE55        Location/Qualifiers
FT   CDS             69957..71174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0055"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   ade:Adeh_0053 membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24275"
FT                   /db_xref="GOA:A7H6C9"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C9"
FT                   /protein_id="ABS24275.1"
FT                   /translation="MPPAGPELSCAMRRALRLALAATLALAACRTVPPPPPQPATTAER
FT                   ALEELSPGAFPAFGDDLDYAGLDAALEGSLQHFARVARADPGRTLAFGKERVPVAKVAA
FT                   SLRRFRELVGARPAPAALREALRREFRVFRSIGDGRGTVLFTGYYLPEIAGSLERGGRY
FT                   QVPLHRAPVDLVQVRARDFPALSADLIGRVRDGRLVPYPTRAEIADGAIAGQGAELAWV
FT                   ASAVDAFFLEIQGSGLLRLPDGTTRVVTYAGKNGHRYEAIGAELIRRGALTREQVSMQA
FT                   IRAWLAANPAEQPLLLATNPSYVFFRFADDAIGSLGVPVTPDRTIAADARVFPKGALAF
FT                   VETERPADATGGPMKPFGRFFLDQDAGGAIKSSARVDLFLGSGAYAESAAGRMKQPGRL
FT                   YYLLLK"
     MPPAGPELSC AMRRALRLAL AATLALAACR TVPPPPPQPA TTAERALEEL SPGAFPAFGD        60
     DLDYAGLDAA LEGSLQHFAR VARADPGRTL AFGKERVPVA KVAASLRRFR ELVGARPAPA       120
     ALREALRREF RVFRSIGDGR GTVLFTGYYL PEIAGSLERG GRYQVPLHRA PVDLVQVRAR       180
     DFPALSADLI GRVRDGRLVP YPTRAEIADG AIAGQGAELA WVASAVDAFF LEIQGSGLLR       240
     LPDGTTRVVT YAGKNGHRYE AIGAELIRRG ALTREQVSMQ AIRAWLAANP AEQPLLLATN       300
     PSYVFFRFAD DAIGSLGVPV TPDRTIAADA RVFPKGALAF VETERPADAT GGPMKPFGRF       360
     FLDQDAGGAI KSSARVDLFL GSGAYAESAA GRMKQPGRLY YLLLK                       405
//

If you have problems or comments...

PBIL Back to PBIL home page