(data stored in ACNUC7421 zone)

EMBL: CP000769.PE558

CP000769.PE558       Location/Qualifiers
FT   CDS             642992..644266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0564"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   ade:Adeh_2207 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24778"
FT                   /db_xref="GOA:A7H7T2"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR030809"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T2"
FT                   /protein_id="ABS24778.1"
FT                   /translation="MGETLTGWVADARRRTLELASALTEEQLLGPRLAIVNPPLWELGH
FT                   VAWFQERWVLRHGAGRPPLRADGDALYDSFAVAHDTRWSLPLPGLAETIDYLRGVEAGV
FT                   LSLAGRGEADPYLVRLTVFHEDMHFEAMAFTHQTLGYAAPVVSGAAPAEAGGGDLPGDV
FT                   EVPGGTLRLGAERGEGFVFDNEKWAHAVELAPFRISRAPVTQARFAEFVEDGGYRRREW
FT                   WTEEGWRWREATGAGAPAYWERRGGSWFRRDFDRWVPLEPHRPVVNVSWFEAQAFCRWA
FT                   GRRLPTEAEWEAAAAGEPGADGRLAPRKRRFPWGDAPPEPSRAHLGVPALGALDVGALS
FT                   AGDSAFGCRQLLGNVWEWTASDFLPYPGFSPDAYREYSEPWFGTHKVLRGGSFATQPRL
FT                   AWNTFRNFYTPDRRDQWAGFRTCAV"
     MGETLTGWVA DARRRTLELA SALTEEQLLG PRLAIVNPPL WELGHVAWFQ ERWVLRHGAG        60
     RPPLRADGDA LYDSFAVAHD TRWSLPLPGL AETIDYLRGV EAGVLSLAGR GEADPYLVRL       120
     TVFHEDMHFE AMAFTHQTLG YAAPVVSGAA PAEAGGGDLP GDVEVPGGTL RLGAERGEGF       180
     VFDNEKWAHA VELAPFRISR APVTQARFAE FVEDGGYRRR EWWTEEGWRW REATGAGAPA       240
     YWERRGGSWF RRDFDRWVPL EPHRPVVNVS WFEAQAFCRW AGRRLPTEAE WEAAAAGEPG       300
     ADGRLAPRKR RFPWGDAPPE PSRAHLGVPA LGALDVGALS AGDSAFGCRQ LLGNVWEWTA       360
     SDFLPYPGFS PDAYREYSEP WFGTHKVLRG GSFATQPRLA WNTFRNFYTP DRRDQWAGFR       420
     TCAV                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page